PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.12G072000.1.p
Common NameGLYMA_12G072000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 203aa    MW: 22029.1 Da    PI: 5.6692
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.12G072000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.97.2e-43351341100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l
  Glyma.12G072000.1.p  35 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVTSMVYEASARIRDPVYGCAGAICQLQKQINEL 124
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la++++e
  Glyma.12G072000.1.p 125 QAQLAKAQAE 134
                          ******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.54934135IPR004883Lateral organ boundaries, LOB
PfamPF031956.1E-4335132IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MENSDISSAP LSHSPTNSSS SSPTPPSPPT VVMSPCAACK ILRRRCAEKC VLAPYFPPTE  60
PAKFTIAHRV FGASNIIKFL QELPESQRAD AVTSMVYEAS ARIRDPVYGC AGAICQLQKQ  120
INELQAQLAK AQAELVNMQI QQANLVALIC MKMAQSPQES PQQLVDDFIS TPPHSGGAYQ  180
SGMNFFEDNT SLNSLWEQPL WT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.365590.0cotyledon| meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971750.0BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304478.11e-148LOB domain-containing protein 1-like
SwissprotQ9LQR04e-78LBD1_ARATH; LOB domain-containing protein 1
TrEMBLI1LQZ61e-149I1LQZ6_SOYBN; Uncharacterized protein
STRINGGLYMA12G07650.11e-148(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-65LOB domain-containing protein 1